COQ6 Antibody - N-terminal region - HRP

Referência ARP64161_P050-HRP

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

COQ6 Antibody - N-terminal region : HRP (ARP64161_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-COQ6 (ARP64161_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 80%
Peptide SequenceSynthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA
Concentration0.5 mg/ml
Blocking PeptideFor anti-COQ6 (ARP64161_P050-HRP) antibody is Catalog # AAP64161
Gene SymbolCOQ6
Alias SymbolsCGI10, CGI-10, COQ10D6
NCBI Gene Id51004
Protein NameUbiquinone biosynthesis monooxygenase COQ6
Description of TargetThe protein encoded by this gene belongs to the ubiH/COQ6 family. It is an evolutionarily conserved monooxygenase required for the biosynthesis of coenzyme Q10 (or ubiquinone), which is an essential component of the mitochondrial electron transport chain, and one of the most potent lipophilic antioxidants implicated in the protection of cell damage by reactive oxygen species. Knockdown of this gene in mouse and zebrafish results in decreased growth due to increased apoptosis. Mutations in this gene are associated with autosomal recessive coenzyme Q10 deficiency-6 (COQ10D6), which manifests as nephrotic syndrome with sensorineural deafness. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Uniprot IDQ9Y2Z9-3
Protein Accession #NP_872286
Nucleotide Accession #NM_182480
Protein Size (# AA)443
Molecular Weight48kDa
Protein InteractionsSUMO1; UBC; NEDD8; APP; CDK2; ZBTB16; ARSE;