Apbb1ip Antibody - N-terminal region - Biotin
Referência ARP57311_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Apbb1ip Antibody - N-terminal region : Biotin (ARP57311_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Apbb1ip (ARP57311_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Apbb1ip (ARP57311_P050-Biotin) antibody is Catalog # AAP57311 (Previous Catalog # AAPP41127) |
| Gene Symbol | Apbb1ip |
|---|---|
| Gene Full Name | Amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein |
| Alias Symbols | Apbb1ip |
| NCBI Gene Id | 307171 |
| Description of Target | The function of Apbb1ip remains unknown. |
| Protein Accession # | NP_001094047 |
| Nucleotide Accession # | NM_001100577 |
| Protein Size (# AA) | 664 |
| Molecular Weight | 74kDa |





