Apbb1ip Antibody - N-terminal region - Biotin

Referencia ARP57311_P050-Biotin

embalaje : 100ul

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

Apbb1ip Antibody - N-terminal region : Biotin (ARP57311_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-Apbb1ip (ARP57311_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Apbb1ip (ARP57311_P050-Biotin) antibody is Catalog # AAP57311 (Previous Catalog # AAPP41127)
Gene SymbolApbb1ip
Gene Full NameAmyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Alias SymbolsApbb1ip
NCBI Gene Id307171
Description of TargetThe function of Apbb1ip remains unknown.
Protein Accession #NP_001094047
Nucleotide Accession #NM_001100577
Protein Size (# AA)664
Molecular Weight74kDa