TNMD antibody - N-terminal region

Referencia ARP49696_P050

embalaje : 100ul

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

TNMD Antibody - N-terminal region (ARP49696_P050)

Datasheets/ManualsPrintable datasheet for anti-TNMD (ARP49696_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TNMD
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNMD (ARP49696_P050) antibody is Catalog # AAP49696 (Previous Catalog # AAPP29277)
Enhanced Validation
Relative Expression (Western Blot)
Avivasheild
ReferenceTolppanen,A.M., (2007) Obesity (Silver Spring) 15 (5), 1082-1088
Gene SymbolTNMD
Gene Full NameTenomodulin
Alias SymbolsTEM, CHM1L, BRICD4
NCBI Gene Id64102
Protein NameTenomodulin
Description of TargetTNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.
Uniprot IDQ9H2S6
Protein Accession #NP_071427
Nucleotide Accession #NM_022144
Protein Size (# AA)317
Molecular Weight37 kDa
Protein InteractionsTMEM79;

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
ARP46705_T100
 100ul 
ARP48845_P050
 100ul 
ARP45410_P050
 100ul