ST3GAL3 antibody - C-terminal region

Referencia ARP46705_T100

embalaje : 100ul

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

ST3GAL3 Antibody - C-terminal region (ARP46705_T100)

Datasheets/ManualsPrintable datasheet for anti-ST3GAL3 (ARP46705_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD
Concentration1.0 mg/ml
Blocking PeptideFor anti-ST3GAL3 (ARP46705_T100) antibody is Catalog # AAP46705 (Previous Catalog # AAPP27507)
Gene SymbolST3GAL3
Gene Full NameST3 beta-galactoside alpha-2,3-sialyltransferase 3
Alias SymbolsST3N, DEE15, MRT12, SIAT6, EIEE15, ST3GALII, ST3GalIII, ST3Gal III
NCBI Gene Id6487
Protein NameCMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
Description of TargetST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.
Uniprot IDQ11203
Protein Accession #EAX07084
Nucleotide Accession #NM_001270459
Protein Size (# AA)268
Molecular Weight30kDa
Protein InteractionsRPL8; ZBTB5; SCAMP2; TTR; ACTG1;

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
ARP49696_P050
 100ul 
ARP48845_P050
 100ul 
ARP45410_P050
 100ul