LRRC8B antibody - middle region
Referencia ARP47145_P050
embalaje : 100ul
Marca : Aviva Systems Biology
LRRC8B Antibody - middle region (ARP47145_P050)
| Datasheets/Manuals | Printable datasheet for anti-LRRC8B (ARP47145_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Additional Information | IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Placenta IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LRRC8B |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-LRRC8B (ARP47145_P050) antibody is Catalog # AAP47145 (Previous Catalog # AAPP27920) |
| Reference | Kubota,K., FEBS Lett. 564 (1-2), 147-152 (2004) |
|---|---|
| Gene Symbol | LRRC8B |
| Gene Full Name | Leucine rich repeat containing 8 family, member B |
| Alias Symbols | TALRRP, TA-LRRP |
| NCBI Gene Id | 23507 |
| Protein Name | Leucine-rich repeat-containing protein 8B |
| Description of Target | The exact function of LRRC8B remains unknown. |
| Uniprot ID | Q6P9F7 |
| Protein Accession # | NP_056165 |
| Nucleotide Accession # | NM_015350 |
| Protein Size (# AA) | 803 |
| Molecular Weight | 92kDa |
| Protein Interactions | CUL3; |



