LRRC8B antibody - middle region

Cat# ARP47145_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

LRRC8B Antibody - middle region (ARP47145_P050)

Datasheets/ManualsPrintable datasheet for anti-LRRC8B (ARP47145_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Additional InformationIHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Placenta
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LRRC8B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE
Concentration0.5 mg/ml
Blocking PeptideFor anti-LRRC8B (ARP47145_P050) antibody is Catalog # AAP47145 (Previous Catalog # AAPP27920)
ReferenceKubota,K., FEBS Lett. 564 (1-2), 147-152 (2004)
Gene SymbolLRRC8B
Gene Full NameLeucine rich repeat containing 8 family, member B
Alias SymbolsTALRRP, TA-LRRP
NCBI Gene Id23507
Protein NameLeucine-rich repeat-containing protein 8B
Description of TargetThe exact function of LRRC8B remains unknown.
Uniprot IDQ6P9F7
Protein Accession #NP_056165
Nucleotide Accession #NM_015350
Protein Size (# AA)803
Molecular Weight92kDa
Protein InteractionsCUL3;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
OACA09837-50UG
 50ug