FUNDC1 antibody - N-terminal region
Marca : Aviva Systems Biology
FUNDC1 Antibody - N-terminal region (ARP53280_P050)
| Datasheets/Manuals | Printable datasheet for anti-FUNDC1 (ARP53280_P050) antibody |
|---|
| Publications | The mitophagy receptors BNIP3 and NIX mediate tight attachment and expansion of the isolation membrane to mitochondria Authors: Yamashita, S. I., Arai, R., et al. Journal: J Cell Biol. 224 (2025) Mitophagy mediated by BNIP3 and NIX protects against ferroptosis by downregulating mitochondrial reactive oxygen species Authors: Yamashita, S. I., Sugiura, Y., et al. Journal: Cell Death Differ. 31, 651-661 (2024) Mechanisms of impaired mitochondrial homeostasis and NAD+ metabolism in a model of mitochondrial heart disease exhibiting redox active iron accumulation Authors: Chiang, S., Braidy, N., et al. Journal: Redox Biol. 46, 102038 (2021) BNIP3L/Nix-induced mitochondrial fission, mitophagy, and impaired myocyte glucose uptake are abrogated by PRKA/PKA phosphorylation Authors: da Silva Rosa, S. C., Martens, M. D., et al. Journal: Autophagy. 17, 2257-2272 (2021) Dynamic PGAM5 multimers dephosphorylate BCL-xL or FUNDC1 to regulate mitochondrial and cellular fate Authors: Ma, K., Zhang, Z., et al. Journal: Cell Death Differ. 27, 1036-1051 (2020) Nix induced mitochondrial fission, mitophagy, and myocyte insulin resistance are abrogated by PKA phosphorylation Authors: da Silva Rosa, S. C., Martens, M. D., et al. Journal: bioRxiv. (2019) Preprint — no PubMed record available BNIP3L/NIX and FUNDC1-mediated mitophagy is required for mitochondrial network remodeling during cardiac progenitor cell differentiation Authors: Lampert, M. A., Orogo, A. M., et al. Journal: Autophagy. 15, 1182-1198 (2019) STX17 dynamically regulated by Fis1 induces mitophagy via hierarchical macroautophagic mechanism Authors: Xian, H., Yang, Q., et al. Journal: Nat Commun. 10, 2059 (2019) Structural basis for the phosphorylation of FUNDC1 LIR as a molecular switch of mitophagy Authors: Kuang, Y., Ma, K., et al. Journal: Autophagy. 12, 2363-2373 (2016) FUNDC1 regulates mitochondrial dynamics at the ER-mitochondrial contact site under hypoxic conditions Authors: Wu, W., Lin, C., et al. Journal: EMBO J. 35, 1368-84 (2016) Phosphorylation of ULK1 by AMPK regulates translocation of ULK1 to mitochondria and mitophagy Authors: Tian, W., Li, W., et al. Journal: FEBS Lett. 589, 1847-54 (2015) MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX Authors: Li, W., Zhang, X., et al. Journal: J Biol Chem. 289, 10691-10701 (2014) Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2α phosphorylation, and the induction of downstream targets Authors: Huang, M. L., Sivagurunathan, S., et al. Journal: Am J Pathol. 183, 745-57 (2013) |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IP |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762) |
| Enhanced Validation |
| Reference | Ross,M.T., (2005) Nature 434 (7031), 325-337 |
|---|---|
| Gene Symbol | FUNDC1 |
| Gene Full Name | FUN14 domain containing 1 |
| Alias Symbols | MGC51029 |
| NCBI Gene Id | 139341 |
| Protein Name | FUN14 domain-containing protein 1 |
| Description of Target | FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown. |
| Uniprot ID | Q8IVP5 |
| Protein Accession # | NP_776155 |
| Nucleotide Accession # | NM_173794 |
| Protein Size (# AA) | 155 |
| Molecular Weight | 17 kDa |
| Protein Interactions | SLC25A46; MAP1LC3A; MAP1LC3B; SENP2; SH3GLB1; MTERF3; GABARAPL1; GABARAPL2; YES1; TUFM; SNX1; EHHADH; CTBP2; CTBP1; UBC; |
-
FUNDC1 Antibody - N-terminal region (OAAB12808)Catalog #: OAAB12808Species Tested: Human, MouseApplication: WBFormat: LiquidPBS with 0.09% (W/V) sodium azide. -
FUNDC1 Antibody - N-terminal region (OASG02855)Catalog #: OASG02855Application: ELISA, IF, WBFormat: Liquid. PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. -
FUNDC1 Antibody - middle region (ARP53281_P050)Catalog #: ARP53281_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.



