Seladin 1 (DHCR24) (NM_014762) Human Recombinant Protein

Referência TP303507

Tamanho : 20ug

Contactar o distribuidor local :


Telefone :

Seladin 1 (DHCR24) (NM_014762) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303507
Recombinant protein of human 24-dehydrocholesterol reductase (DHCR24), 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203507 representing NM_014762
Red=Cloning site Green=Tags(s)

MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQR
VRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMDILEVDTKKQIVRVEPLVTMG
QVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKYGLFQHICTAYELVLADGSFVRCTPSENSDL
FYAVPWSCGTLGFLVAAEIRIIPAKKYVKLRFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIM
TGVMTDEAEPSKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPI
FRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ
PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREEFWEMFDGSLY
HKLREKLGCQDAFPEVYDKICKAARH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055577
Locus ID 1718
UniProt ID Q15392
Cytogenetics 1p32.3
RefSeq Size 4286
RefSeq ORF 1548
Synonyms DCE; Nbla03646; seladin-1; SELADIN1
Summary This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Stem cell - Pluripotency, Transmembrane
Protein Pathways Metabolic pathways, Steroid biosynthesis
SKU Description Size
PH303507 DHCR24 MS Standard C13 and N15-labeled recombinant protein (NP_055577) 10 ug
LC402373 Lyophilized DHCR24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY402373 Transient overexpression lysate of 24-dehydrocholesterol reductase (DHCR24) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT