Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> PEAMT (PEMT) (NM_007169) Human Recombinant Protein

PEAMT (PEMT) (NM_007169) Human Recombinant Protein

Imprimir Imprimir
Please log in

Referência TP323190

Tamanho : 20ug

Contactar o distribuidor local :


Telefone :

PEAMT (PEMT) (NM_007169) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323190
Recombinant protein of human phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
 

Other products for "PEAMT or NM_007169"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223190 representing NM_007169
Red=Cloning site Green=Tags(s)

MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTILLLNFLRSHC
FTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGDYFGILKEARVTVFPFNILDN
PMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009100
Locus ID 10400
UniProt ID Q9UBM1
Cytogenetics 17p11.2
RefSeq Size 1008
RefSeq ORF 597
Synonyms PEAMT; PEMPT; PEMT2; PLMT; PNMT
Summary Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells converts intracellular choline to phosphatidylcholine by a three-step process. The protein isoforms encoded by this gene localize to the endoplasmic reticulum and mitochondria-associated membranes. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. provided by RefSeq, May 2012
Protein Categories Membrane Proteins
Protein Families Transmembrane
Protein Pathways Glycerophospholipid metabolism, Metabolic pathways
FAQs
  • Protein FAQs
SDS
SKU Description Size
PH323190 PEMT MS Standard C13 and N15-labeled recombinant protein (NP_009100) 10 ug
LC402097 Lyophilized PEMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC407769 Lyophilized PEMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC407770 Lyophilized PEMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY402097 Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
LY407769 Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 1 (as WB positive control) 100 ug
LY407770 Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 3 (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT