Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research^[1][2][3].

Insulin swine (2 h) causes a concentration-dependent increase in glucose oxidation in swine adipose tissue^[1].
Insulin swine (1-1000 ng/mL; 2 h) significantly stimulates lipogenesis in the adipose tissue of80-kg pigs, but does not affect glycerol release^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Insulin swine (1 mg; p.o.; twice a week for 5 weeks and then weekly until 1 year of age) delays the onset and reduces the incidence of diabetes in nonobese diabetic mice^[2].
Insulin swine (0.16 U/kg; i.v.) reduces blood glucose levels in diabetic Lewis rats^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

5777.54

C₂₅₆H₃₈₁N₆₅O₇₆S₆

12584-58-6

Solid

White to off-white

Chain 1:Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala Chain 2:Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)

Chain 1:FVNQHLCGSHLVEALYLVCGERGFFYTPKA Chain 2:GIVEQCCTSICSLYQLENYCN (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Walton PE, et al. Stimulation of lipogenesis by insulin in swine adipose tissue: antagonism by porcine growth hormone. J Anim Sci. 1986 Jun;62(6):1584-95.  [Content Brief]

  [2]. Z J Zhang, et al. Suppression of diabetes in nonobese diabetic mice by oral administration of porcine insulin. Proc Natl Acad Sci U S A. 1991 Nov 15;88(22):10252-6.   [Content Brief]

  [3]. Pepper AR, et al. Diabetic rats and mice are resistant to porcine and human insulin: flawed experimental models for testing islet xenografts. Xenotransplantation. 2009 Nov-Dec;16(6):502-10.  [Content Brief]