Insulin (swine) [12584-58-6]
Referência HY-P3479-50mg
Tamanho : 50mg
Marca : MedChemExpress
| Description |
Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research[1][2][3]. |
||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| In Vitro |
Insulin swine (2 h) causes a concentration-dependent increase in glucose oxidation in swine adipose tissue[1]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. |
||||||||||||
| In Vivo |
Insulin swine (1 mg; p.o.; twice a week for 5 weeks and then weekly until 1 year of age) delays the onset and reduces the incidence of diabetes in nonobese diabetic mice[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
|
||||||||||||
| Masse moléculaire |
5777.54 |
||||||||||||
| Formule |
C256H381N65O76S6 |
||||||||||||
| CAS No. | |||||||||||||
| Appearance |
Solid |
||||||||||||
| Color |
White to off-white |
||||||||||||
| Sequence |
Chain 1:Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala Chain 2:Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11) |
||||||||||||
| Sequence Shortening |
Chain 1:FVNQHLCGSHLVEALYLVCGERGFFYTPKA Chain 2:GIVEQCCTSICSLYQLENYCN (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11) |
||||||||||||
| Livraison | Room temperature in continental US; may vary elsewhere. |
||||||||||||
| Stockage |
Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||||||||
| Solvant et solubilité |
In Vitro:
H2O : 20 mg/mL (3.46 mM; ultrasonic and adjust pH to 3 with HCl) Preparing
Stock Solutions
View the Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles. * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol) Concentration (start) × Volume (start) = Concentration (final) × Volume (final) This equation is commonly abbreviated as: C1V1 = C2V2 In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
Dosage mg/kgAnimal weight Dosing volume Number of animals Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration:
mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
|
||||||||||||
| Pureté et documentation | |||||||||||||
| Références |
|

