U2AF1L4 Antibody - N-terminal region - FITC
Referência ARP40325_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
U2AF1L4 Antibody - N-terminal region : FITC (ARP40325_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-U2AF1L4 (ARP40325_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human U2AF1L4 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-U2AF1L4 (ARP40325_P050-FITC) antibody is Catalog # AAP40325 |
| Gene Symbol | U2AF1L4 |
|---|---|
| Gene Full Name | U2 small nuclear RNA auxiliary factor 1 |
| Alias Symbols | U2af26, U2AF1L3, U2AF1RS3, U2AF1-RS3, U2AF1L3V1 |
| NCBI Gene Id | 199746 |
| Protein Name | Splicing factor U2AF 26 kDa subunit |
| Description of Target | U2AF1L4 is a RNA-binding protein that function as a pre-mRNA splicing factor. It plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. It acts by enhancing the binding of U2AF2 to weak pyrimidine tracts and also participates in the regulation of alternative pre-mRNA splicing. It activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. U2AF1L4 binds to RNA at the AG dinucleotide at the 3'-splice site. |
| Uniprot ID | Q8WU68 |
| Protein Size (# AA) | 220 |
| Molecular Weight | 24kDa |
| Protein Interactions | MDM2; SUZ12; UBC; ELAVL1; GIGYF2; |
