TYRP1 antibody - N-terminal region
Referência ARP44313_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
TYRP1 Antibody - N-terminal region (ARP44313_T100)
| Datasheets/Manuals | Printable datasheet for anti-TYRP1 (ARP44313_T100) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TYRP1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-TYRP1 (ARP44313_T100) antibody is Catalog # AAP44313 (Previous Catalog # AAPP25691) |
| Reference | Forshew,T., (2005) Clin. Genet. 68 (2), 182-184 |
|---|---|
| Gene Symbol | TYRP1 |
| Gene Full Name | Tyrosinase-related protein 1 |
| Alias Symbols | TRP, CAS2, CATB, GP75, OCA3, TRP1, TYRP, b-PROTEIN |
| NCBI Gene Id | 7306 |
| Protein Name | 5,6-dihydroxyindole-2-carboxylic acid oxidase |
| Description of Target | TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized. |
| Uniprot ID | P17643 |
| Protein Accession # | NP_000541 |
| Nucleotide Accession # | NM_000550 |
| Protein Size (# AA) | 537 |
| Molecular Weight | 59kDa |
| Protein Interactions | RAB11A; TF; RAB5A; HSPA4; TYR; GIPC1; |
