TBX19 antibody - N-terminal region
Referência ARP32363_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
TBX19 Antibody - N-terminal region (ARP32363_T100)
| Datasheets/Manuals | Printable datasheet for anti-TBX19 (ARP32363_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352) |
| Reference | Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532 |
|---|---|
| Gene Symbol | TBX19 |
| Gene Full Name | T-box 19 |
| Alias Symbols | TPIT, TBS19, dJ747L4.1 |
| NCBI Gene Id | 9095 |
| Protein Name | T-box transcription factor TBX19 |
| Description of Target | TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. |
| Uniprot ID | O60806 |
| Protein Accession # | NP_005140 |
| Nucleotide Accession # | NM_005149 |
| Protein Size (# AA) | 448 |
| Molecular Weight | 48kDa |
| Protein Interactions | NR5A1; |



