SNU13 Antibody - N-terminal region - HRP
Referência ARP40236_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SNU13 Antibody - N-terminal region : HRP (ARP40236_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SNU13 (ARP40236_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NHP2L1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SNU13 (ARP40236_P050-HRP) antibody is Catalog # AAP40236 (Previous Catalog # AAPP22080) |
| Gene Symbol | SNU13 |
|---|---|
| Gene Full Name | small nuclear ribonucleoprotein 13 |
| Alias Symbols | FA1, FA-1, NHPX, 15.5K, OTK27, SSFA1, NHP2L1, SPAG12, SNRNP15-5 |
| NCBI Gene Id | 4809 |
| Protein Name | NHP2-like protein 1 |
| Description of Target | Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. |
| Uniprot ID | P55769 |
| Protein Accession # | NP_001003796 |
| Nucleotide Accession # | NM_001003796 |
| Protein Size (# AA) | 128 |
| Molecular Weight | 14kDa |
| Protein Interactions | UBC; MDM2; LIN28A; SUZ12; RNF2; BMI1; EED; KIAA0196; ROCK2; ZW10; PRPF4; SRPK3; ITGA4; FN1; MAP1LC3B; gag; SNW1; CHST1; VCAM1; WDR18; PCDHA2; PRPF40A; NOP58; NOP16; TRA2A; RRP7A; GNL3; RSL1D1; PRPF6; BOP1; RRS1; SUPT16H; RNPS1; UTP14A; SRSF10; STAG2; NOP5 |
