Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO)

Referência NB-64-49070-20ug

Tamanho : 20ug

Marca : Neo Biotech

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.4 kDa and the accession number is P0CC05.
Species
Chlamydia trachomatis
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberP0CC05
Synonyms
Small-CRP,Small cysteine-rich outer membrane protein OmcA,omp3,omp2A,omcA,9 kDa cysteine-rich lipoprotein (9kDa-CRP)
Amino Acid
CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
Construction
19-88 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight23.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.

Dose Conversion

You can also refer to dose conversion for different animals. More