SARS Antibody - middle region - FITC
Referência ARP40655_T100-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SARS Antibody - middle region : FITC (ARP40655_T100-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-SARS (ARP40655_T100-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SARS |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SARS (ARP40655_T100-FITC) antibody is Catalog # AAP40655 (Previous Catalog # AAPY00907) |
| Reference | Shimada,N., (2001) J. Biol. Chem. 276 (50), 46770-46778 |
|---|---|
| Gene Symbol | SARS |
| Gene Full Name | Seryl-tRNA synthetase |
| Alias Symbols | SARS, SERS, SERRS, NEDMAS |
| NCBI Gene Id | 6301 |
| Protein Name | Serine--tRNA ligase, cytoplasmic |
| Description of Target | SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts. |
| Uniprot ID | Q5T5C8 |
| Protein Accession # | NP_006504 |
| Nucleotide Accession # | NM_006513 |
| Protein Size (# AA) | 514 |
| Molecular Weight | 57kDa |
| Protein Interactions | UBC; TBCD; STAT1; GTF2E1; GTF2A1; CTTN; ATP6V1C1; ANP32E; ACBD3; ELAC2; XPO5; DUS3L; SNX5; ASF1A; ATG7; EFTUD2; TTC1; gag-pol; GATC; PALLD; TARS; CDK2; TINF2; POT1; TERF1; MYC; UBA5; TRS-AGA2-4; JUN; SIRT2; |
