- Specifications
Product Description
Human RXRA partial ORF (NP_002948.1, 27 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.89
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — RXRA
Entrez GeneID
6256GeneBank Accession#
NM_002957Protein Accession#
NP_002948.1Gene Name
RXRA
Gene Alias
FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1
Gene Description
retinoid X receptor, alpha
Omim ID
180245Gene Ontology
HyperlinkGene Summary
Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. [provided by RefSeq
Other Designations
OTTHUMP00000022510
- Interactomes
- Pathways
- Diseases
RXRA (Human) Recombinant Protein
Referência H00006256-Q02-25ug
Tamanho : 25ug
Marca : Abnova
Images


