RS1 Recombinant Protein
Referência OPCA01829-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
RS1 Recombinant Protein (Human) (OPCA01829)
| Datasheets/Manuals | Printable datasheet for RS1 Recombinant Protein (Human) (OPCA01829) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Human |
| Additional Information | Relevance: May be active in cell adhesion processes during retinal development. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA |
| Protein Sequence | STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 24-224 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Clinical and genetic findings in Hungarian patients with X-linked juvenile retinoschisis.Lesch B., Szabo V., Kanya M., Somfai G.M., Vamos R., Varsanyi B., Pamer Z., Knezy K., Salacz G., Janaky M., Ferencz M., Hargitai J., Papp A., Farkas A.Mol. Vis. 14:2321-2332(2008) |
|---|---|
| Gene Symbol | RS1 |
| Gene Full Name | retinoschisin 1 |
| Alias Symbols | retinoschisin, RS, X-linked juvenile retinoschisis protein, XLRS1. |
| NCBI Gene Id | 6247 |
| Protein Name | Retinoschisin |
| Description of Target | Binds negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides (By similarity). May play a role in cell-cell adhesion processes in the retina, via homomeric interaction between octamers present on the surface of two neighboring cells (PubMed:27114531). Required for normal structure and function of the retina (PubMed:19093009). |
| Uniprot ID | O15537 |
| Protein Accession # | NP_000321.1 |
| Nucleotide Accession # | NM_000330.3 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 27 kDa |
