RRAD antibody - middle region
Referência ARP56566_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-RRAD (ARP56566_P050) antibody |
---|
Tested Species Reactivity | Human | ||||||
---|---|---|---|---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RRAD | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-RRAD (ARP56566_P050) antibody is Catalog # AAP56566 (Previous Catalog # AAPP39223) | ||||||
Enhanced Validation |
|
Reference | Chang,L., (2007) Circulation 116 (25), 2976-2983 |
---|---|
Gene Symbol | RRAD |
Gene Full Name | Ras-related associated with diabetes |
Alias Symbols | RAD, RAD1, REM3 |
NCBI Gene Id | 6236 |
Protein Name | GTP-binding protein RAD |
Description of Target | RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy |
Uniprot ID | P55042 |
Protein Accession # | NP_004156 |
Nucleotide Accession # | NM_004165 |
Protein Size (# AA) | 308 |
Molecular Weight | 33kDa |
Protein Interactions | PRKCA; PRKACA; CSNK2B; CSNK2A1; CAMK2G; CALM1; MMP14; TPM2; YWHAZ; PRKCB; NME1; |