RNF12 Antibody - C-terminal region - FITC
Referência ARP32151_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
RNF12 Antibody - C-terminal region : FITC (ARP32151_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-RLIM (ARP32151_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RNF12 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 89%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-RLIM (ARP32151_P050-FITC) antibody is Catalog # AAP32151 (Previous Catalog # AAPP03121) |
| Sample Type Confirmation | RLIM is supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Hiratani, I.,et al., (2003) Development 130 (17), 4161-4175 |
|---|---|
| Gene Symbol | RLIM |
| Gene Full Name | Ring finger protein, LIM domain interacting |
| Alias Symbols | MRX61, RNF12, TOKAS, NY-REN-43 |
| NCBI Gene Id | 51132 |
| Protein Name | E3 ubiquitin-protein ligase RLIM |
| Description of Target | RNF12 is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported. |
| Uniprot ID | Q9NVW2 |
| Protein Accession # | NP_057204 |
| Nucleotide Accession # | NM_016120 |
| Protein Size (# AA) | 624 |
| Molecular Weight | 69kDa |
| Protein Interactions | STMN1; SNX17; UBC; RPS14; TNFAIP3; UBE2D1; LNX2; TERF1; SMURF2; HHV8GK18_gp81; HDAC2; REXO1; TOLLIP; LDB1; UBXN1; UBE2E2; SIAH1; SS18L1; STAT6; UBE2D4; UBE2E1; UBE2D3; UBE2D2; LDB2; SIN3A; PDLIM1; LHX1; LHX2; LIMK1; LHX3; ISL1; LMO2; RLIM; ESR1; |
