PHB2 Antibody - N-terminal region - Biotin
Referência ARP48315_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
PHB2 Antibody - N-terminal region : Biotin (ARP48315_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PHB2 (ARP48315_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PHB2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PHB2 (ARP48315_P050-Biotin) antibody is Catalog # AAP48315 (Previous Catalog # AAPY01685) |
| Reference | Ross,J.A., (2008) J. Biol. Chem. 283 (8), 4699-4713 |
|---|---|
| Gene Symbol | PHB2 |
| Gene Full Name | Prohibitin 2 |
| Alias Symbols | BAP, REA, p22, hBAP, Bap37, BCAP37, PNAS-141 |
| NCBI Gene Id | 11331 |
| Protein Name | Prohibitin-2 |
| Description of Target | PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging. |
| Uniprot ID | Q99623 |
| Protein Accession # | NP_009204 |
| Nucleotide Accession # | NM_007273 |
| Protein Size (# AA) | 299 |
| Molecular Weight | 33kDa |
| Protein Interactions | HUWE1; IGF1R; HDAC1; ESR1; KIAA1244; NCOR1; SUMO2; STAU1; UBC; MDM2; ASB14; ASB17; SUZ12; EED; RNF2; UPF2; ADRB2; CDK2; env; VCAM1; TEAD3; ITGA4; ILF3; FN1; ATF2; C1QBP; AFP; UBL4A; EPAS1; FMNL1; PAXIP1; MDC1; MYOD1; MEF2A; FHL2; ECT2; BRCA1; AKT1; Htt; U |
