PACRG Antibody - middle region - HRP
Referência ARP52953_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
PACRG Antibody - middle region : HRP (ARP52953_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-PACRG (ARP52953_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PACRG |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PACRG (ARP52953_P050-HRP) antibody is Catalog # AAP52953 (Previous Catalog # AAPP35007) |
| Reference | Taylor,J.M., (2007) Neurobiol. Dis. 27 (2), 238-247 |
|---|---|
| Gene Symbol | PACRG |
| Gene Full Name | PARK2 co-regulated |
| Alias Symbols | GLUP, PACRG2.1, PARK2CRG, HAK005771 |
| NCBI Gene Id | 135138 |
| Protein Name | Parkin coregulated gene protein |
| Description of Target | PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death.This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | Q96M98 |
| Protein Accession # | NP_689623 |
| Nucleotide Accession # | NM_152410 |
| Protein Size (# AA) | 296 |
| Molecular Weight | 33kDa |
| Protein Interactions | UBC; TUBB; HOPX; CCT5; CCT8; CCT2; CCT4; CCT7; STUB1; TUBA1A; VCP; CCT3; TCP1; PARK2; HSP90AA1; HSPA4; DNAJA1; GPR37; CCT6A; APP; |
