OTX1 Antibody - N-terminal region - FITC
Referência ARP39102_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
OTX1 Antibody - N-terminal region : FITC (ARP39102_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-OTX1 (ARP39102_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OTX1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-OTX1 (ARP39102_P050-FITC) antibody is Catalog # AAP39102 (Previous Catalog # AAPP21211) |
| Reference | Hillier,L.W., (2005) Nature 434 (7034), 724-731 |
|---|---|
| Gene Symbol | OTX1 |
| Gene Full Name | Orthodenticle homeobox 1 |
| Alias Symbols | FLJ38361, MGC15736 |
| NCBI Gene Id | 5013 |
| Protein Name | Homeobox protein OTX1 |
| Description of Target | OTX1 probably plays a role in the development of the brain and the sense organs. OTX1 can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. |
| Uniprot ID | P32242 |
| Protein Accession # | NP_055377 |
| Nucleotide Accession # | NM_014562 |
| Protein Size (# AA) | 354 |
| Molecular Weight | 37kDa |
| Protein Interactions | KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP12-2; LCE2D; LCE2A; LCE1B; LCE4A; MGAT5B; KRTAP3-3; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP4-11; GEMIN8P4; KRTAP5-6; KRTAP26-1; KRTAP12-4; KRTAP3-2; KCNK16; KRTAP4-12; RGS17; RB |
