ompD Recombinant Protein
Referência OPCA02059-100UG
Tamanho : 100ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
OMPD Recombinant Protein (Salmonella typhimurium) (OPCA02059)
| Datasheets/Manuals | Printable datasheet for OMPD Recombinant Protein (Salmonella typhimurium) (OPCA02059) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhimurium |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Salmonella typhimurium |
| Additional Information | Relevance: Forms pores that allow passive diffusion of small molecules across the outer mbrane. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF |
| Protein Sequence | AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 22-362 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001) |
|---|---|
| Gene Symbol | nmpC |
| Gene Full Name | phosphoporin PhoE |
| Alias Symbols | STM1572. |
| NCBI Gene Id | 1253090 |
| Protein Name | Outer membrane porin protein OmpD |
| Description of Target | Forms pores that allow passive diffusion of small molecules across the outer membrane. |
| Uniprot ID | P37592 |
| Protein Accession # | NP_460531.1 |
| Nucleotide Accession # | NC_003197.1 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 53.6 kDa |