OCLN Antibody - N-terminal region
Referência ARP42889_P050-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
OCLN Antibody - N-terminal region (ARP42889_P050)
| Datasheets/Manuals | Printable datasheet for anti-OCLN (ARP42889_P050) antibody |
|---|
| Publications | Induction of VEGFA and Snail-1 by meningitic Escherichia coli mediates disruption of the blood-brain barrier. Oncotarget. 7, 63839-63855 (2016). 27588479 |
|---|---|
| Tested Species Reactivity | Human, Rat |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OCLN |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82% |
| Peptide Sequence | Synthetic peptide located within the following region: VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-OCLN (ARP42889_P050) antibody is Catalog # AAP42889 (Previous Catalog # AAPP11114) |
| Reference | Shen,L., (2008) J. Cell Biol. 181 (4), 683-695 |
|---|---|
| Gene Symbol | OCLN |
| Gene Full Name | Occludin |
| Alias Symbols | BLCPMG |
| NCBI Gene Id | 4950 |
| Protein Name | Occludin |
| Description of Target | OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q16625 |
| Protein Accession # | NP_002529 |
| Nucleotide Accession # | NM_002538 |
| Protein Size (# AA) | 522 |
| Molecular Weight | 59kDa |
