NOLC1 antibody - C-terminal region
Referência ARP46110_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
NOLC1 Antibody - C-terminal region (ARP46110_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-NOLC1 (ARP46110_T100) antibody |
|---|
| Tested Species Reactivity | Human, Zebrafish |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Additional Information | IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NOLC1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-NOLC1 (ARP46110_T100) antibody is Catalog # AAP46110 (Previous Catalog # AAPP26972) |
| Sample Type Confirmation | NOLC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Wang,C., (2002) Mol. Cell. Biol. 22 (24), 8457-8466 |
|---|---|
| Gene Symbol | NOLC1 |
| Gene Full Name | Nucleolar and coiled-body phosphoprotein 1 |
| Alias Symbols | P130, Srp40, NOPP130, NOPP140, NS5ATP13 |
| NCBI Gene Id | 9221 |
| Protein Name | Nucleolar and coiled-body phosphoprotein 1 |
| Description of Target | Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I. |
| Uniprot ID | Q14978 |
| Protein Accession # | NP_004732 |
| Nucleotide Accession # | NM_004741 |
| Protein Size (# AA) | 699 |
| Molecular Weight | 73kDa |
| Protein Interactions | UBC; SUMO1; ERG; WWOX; SUZ12; EED; RNF2; RABEP2; CD2AP; SPAG9; YWHAQ; YWHAE; CSNK2A2; PAN2; gag; PNKP; WHSC1; SAP18; G3BP1; GPRC5A; PTRF; NOP58; NOP16; RRP7A; RSL1D1; RRS1; UTP14A; RPL19; RPL18A; RPL15; RPL11; RPL6; RPL5; RPL4; NHP2L1; IK; GTF3C1; FBL; AP |