Metallothionein-1 Recombinant Protein
Referência OPCA02086-100UG
Tamanho : 100ug
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for MT Recombinant Protein (Zebrafish) (OPCA02086) |
---|
Predicted Species Reactivity | Danio rerio|Zebrafish |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Zebrafish |
Additional Information | Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ |
Protein Sequence | MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-60 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | The use of metallothionein genes for determining the phylogenetic and evolutionary relationship between extant teleosts.Kille P., Olsson P.-E. |
---|---|
Gene Symbol | mt |
Gene Full Name | metallothionein-1 |
Alias Symbols | metallothionein A, metallothionein-1, MT-1, mt1. |
NCBI Gene Id | 30282 |
Protein Name | Metallothionein-1 |
Description of Target | Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
Uniprot ID | P52722 |
Protein Accession # | NP_571150.1 |
Nucleotide Accession # | NM_131075.1 |
Protein Size (# AA) | Full Length |
Molecular Weight | 22 kda |