LMP1 Recombinant Protein
Referência OPCA01989-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
LMP1 Recombinant Protein (HHV-4) (OPCA01989)
| Datasheets/Manuals | Printable datasheet for LMP1 Recombinant Protein (HHV-4) (OPCA01989) |
|---|
| Predicted Species Reactivity | Epstein-Barr virus|Epstein-Barr Virus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Epstein-Barr virus |
| Additional Information | Relevance: Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. It is a short-lived protein probably degraded by the proteasome . |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
| Protein Sequence | YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 185-386 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Sequence analysis of Raji Epstein-Barr virus DNA.Hatfull G., Bankier A.T., Barrell B.G., Farrell P.J.Virology 164:334-340(1988) |
|---|---|
| Gene Symbol | LMP1 |
| Alias Symbols | Protein p63. |
| Protein Name | Latent membrane protein 1 |
| Description of Target | Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. |
| Uniprot ID | P13198 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 37 kDa |