LARP7 antibody - C-terminal region
Referência ARP40847_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
LARP7 Antibody - C-terminal region (ARP40847_P050)
| Datasheets/Manuals | Printable datasheet for anti-LARP7 (ARP40847_P050) antibody |
|---|
| Publications | The HIV-1 Tat protein recruits a ubiquitin ligase to reorganize the 7SK snRNP for transcriptional activation |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LARP7 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-LARP7 (ARP40847_P050) antibody is Catalog # AAP40847 (Previous Catalog # AAPY01099) |
| Reference | Krueger,B.J., (2008) Nucleic Acids Res. 36 (7), 2219-2229 |
|---|---|
| Gene Symbol | LARP7 |
| Gene Full Name | La ribonucleoprotein domain family, member 7 |
| Alias Symbols | ALAZS, PIP7S, hLARP7, HDCMA18P |
| NCBI Gene Id | 51574 |
| Protein Name | La-related protein 7 |
| Description of Target | The function remains unknown. |
| Uniprot ID | Q4G0J3 |
| Protein Accession # | NP_056269 |
| Nucleotide Accession # | NM_015454 |
| Protein Size (# AA) | 582 |
| Molecular Weight | 67kDa |
| Protein Interactions | HEXIM1; AFF1; CDK9; CCNT1; UBC; LIN28B; LIN28A; MEPCE; RNF2; VCPIP1; RABEP2; BRCC3; RPP25; CD2AP; JMJD6; HNRNPR; TRIM28; HUWE1; MTA2; SPAG9; TSC22D1; HDAC1; NR3C1; RN7SK; RPS16; HNRNPA1; CSNK2A1; tat; PAXIP1; BARD1; APP; CAND1; SIRT7; PRPF40A; Ybx1; Nhp2l |
