Kera Antibody - C-terminal region
Referência ARP52276_P050-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Kera antibody - C-terminal region (ARP52276_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-Kera (ARP52276_P050) antibody |
|---|
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Goat: 80%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Kera (ARP52276_P050) antibody is Catalog # AAP52276 |
| Enhanced Validation |
| Gene Symbol | Kera |
|---|---|
| Gene Full Name | Keratocan |
| Alias Symbols | CN, SL, KTN, CNA2, SLRR2B |
| NCBI Gene Id | 16545 |
| Protein Name | Keratocan |
| Description of Target | Kera may be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. |
| Uniprot ID | O35367 |
| Protein Accession # | NP_032464 |
| Nucleotide Accession # | NM_008438 |
| Protein Size (# AA) | 351 |
| Molecular Weight | 39 kDa |



