inlA Recombinant Protein
Referência OPCA02325-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
INLA Recombinant Protein (Listeria monocytogenes serotype 4b) (OPCA02325)
| Datasheets/Manuals | Printable datasheet for INLA Recombinant Protein (Listeria monocytogenes serotype 4b) (OPCA02325) |
|---|
| Predicted Species Reactivity | Listeria monocytogenes |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Listeria monocytogenes serotype 4b |
| Additional Information | Relevance: Mediates the entry of Listeria monocytogenes into cells. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT |
| Protein Sequence | QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 562-770 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Whole genome comparisons of serotype 4b and 1/2a strains of the food-borne pathogen Listeria monocytogenes reveal new insights into the core genome components of this species.Nelson K.E., Fouts D.E., Mongodin E.F., Ravel J., DeBoy R.T., Kolonay J.F., Rasko D.A., Angiuoli S.V., Gill S.R., Paulsen I.T., Peterson J.D., White O., Nelson W.C., Nierman W.C., Beanan M.J., Brinkac L.M., Daugherty S.C., Dodson R.J. , Durkin A.S., Madupu R., Haft D.H., Selengut J., Van Aken S.E., Khouri H.M., Fedorova N., Forberger H.A., Tran B., Kathariou S., Wonderling L.D., Uhlich G.A., Bayles D.O., Luchansky J.B., Fraser C.M.Nucleic Acids Res. 32:2386-2395(2004) |
|---|---|
| Gene Symbol | INLA |
| Alias Symbols | inlA, LMOf2365_0471, Internalin A |
| Protein Name | Internalin-A |
| Description of Target | Mediates the entry of Listeria monocytogenes into cells. |
| Uniprot ID | Q723K6 |
| Protein Accession # | WP_003734628.1 |
| Nucleotide Accession # | NC_002973.6 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 38.5 kda |
