IKZF1 Antibody - middle region - HRP
Referência ARP31470_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
IKZF1 Antibody - middle region : HRP (ARP31470_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-IKZF1 (ARP31470_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IKZF1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-IKZF1 (ARP31470_P050-HRP) antibody is Catalog # AAP31470 (Previous Catalog # AAPP24065) |
| Reference | Loeper,S., (2008) Cancer Res. 68 (10), 3715-3723 |
|---|---|
| Gene Symbol | IKZF1 |
| Gene Full Name | IKAROS family zinc finger 1 (Ikaros) |
| Alias Symbols | IK1, LYF1, LyF-1, CVID13, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452 |
| NCBI Gene Id | 10320 |
| Protein Name | DNA-binding protein Ikaros |
| Description of Target | IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development. |
| Uniprot ID | Q13422 |
| Protein Accession # | NP_006051 |
| Nucleotide Accession # | NM_006060 |
| Protein Size (# AA) | 519 |
| Molecular Weight | 57kDa |
| Protein Interactions | PRKAB2; PIN1; FGF12; DDX6; DCX; CTBP2; CTBP1; CKS1B; BYSL; FAM74A4; C1orf174; CEP57L1; ALKBH3; ZMAT2; ZNF417; FRMD6; SPATC1L; FAM161A; FAM214B; ARMC7; NOC4L; SCNM1; C8orf33; AEN; GMCL1P1; KIF9; SH2D4A; CBX8; LMO3; C19orf66; C1orf109; SYT17; ZNF581; FAM50B |
