Human Novel Coronavirus Nucleoprotein(N) 100 µg

Referência AS204388-100

Tamanho : 100ug

Marca : Agrisera

Contactar o distribuidor local :


Telefone : +1 850 650 7790

IKP

Human Novel Coronavirus Nucleoprotein(N) 100 µg

Product no: AS20 4388-100
AS20 4388-100 | Recombinant protein (positive control
    Product Info
    Format: Lyophilized
    Quantity: 100 µg
    Storage: Store lyophilized/reconstituted at -20°C/-80°C. Reconstitute in deionized sterile water to a concentration from 0.1-1.0 mg/ml and add 5-50% of glycerol (final concentration). 50 % glycerol is a default final recommended concentration. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube. Working aliquotes can be stored at 4℃ for up to one week.Shelf life of liquid form is 6 monthss at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
    Tested applications: ELISA (ELISA), Western blot (WB)
    Application Examples
    Application examples

    Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000  and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.

    Note: Predicted band size: 48 kDa Observed band size: 55 kDa





    Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC50  43.50-118.4 ng/ml.

    Application examples

    Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000  and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.

    Note: Predicted band size: 48 kDa Observed band size: 55 kDa





    Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC50  43.50-118.4 ng/ml.

    Additional Information
    Additional information (application): N-terminal His tagged Nucleoprotein (N) (6xHis) was overexpressed in E.coli in the region 1-419 amino acids UniProt P0DTC9: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASW
    FTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSP
    RWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQL
    PQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNG
    GDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAY
    NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIG
    MEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKA
    DETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

    This product is a positive control for Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387).

    Purity: >90 % as confirmed by SDS-PAGE
    Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 N-terminal His tagged Nucleoprotein (N) (6xHis) was overexpressed in E.coli in the region 1-419 amino acids UniProt P0DTC9: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASW
    FTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSP
    RWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQL
    PQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNG
    GDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

    Purity: >90 % as confirmed by SDS-PAGE
    Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
    Background
    Background: Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid (RNP).

    Alternative names:
    NC, Protein N, Nucleocapsid protein
    Protocols Antibody protocols Reviews:
  • This product doesn't have any reviews.