HSD3B1 Antibody - N-terminal region - HRP
Referência ARP41821_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
HSD3B1 Antibody - N-terminal region : HRP (ARP41821_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-HSD3B1 (ARP41821_P050-HRP) antibody |
|---|
| Tested Species Reactivity | Human, Monkey |
|---|---|
| Predicted Species Reactivity | Human, Goat, Monkey |
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Goat: 82%; Human: 100%; Monkey: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HSD3B1 (ARP41821_P050-HRP) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869) |
| Reference | Ross,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847 |
|---|---|
| Gene Symbol | HSD3B1 |
| Gene Full Name | Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 |
| Alias Symbols | HSD3B, HSDB3, HSDB3A, SDR11E1, 3BETAHSD |
| NCBI Gene Id | 3283 |
| Protein Name | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 |
| Description of Target | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. |
| Uniprot ID | P14060 |
| Protein Accession # | NP_000853 |
| Nucleotide Accession # | NM_000862 |
| Protein Size (# AA) | 373 |
| Molecular Weight | 42kDa |
