HOXC9 antibody - N-terminal region
Referência ARP38876_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
HOXC9 Antibody - N-terminal region (ARP38876_T100)
| Datasheets/Manuals | Printable datasheet for anti-HOXC9 (ARP38876_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC9 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-HOXC9 (ARP38876_T100) antibody is Catalog # AAP38876 (Previous Catalog # AAPP21082) |
| Reference | Kosaki,K., (2002) Teratology 65 (2), 50-62 |
|---|---|
| Gene Symbol | HOXC9 |
| Gene Full Name | Homeobox C9 |
| Alias Symbols | HOX3, HOX3B |
| NCBI Gene Id | 3225 |
| Protein Name | Homeobox protein Hox-C9 |
| Description of Target | HOXC9 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. |
| Uniprot ID | P31274 |
| Protein Accession # | NP_008828 |
| Nucleotide Accession # | NM_006897 |
| Protein Size (# AA) | 260 |
| Molecular Weight | 29kDa |
| Protein Interactions | LPXN; ZNF384; CBX6; GTF2A1L; IRF9; NMI; PCGF2; ZFP36; POU2F1; POLR2D; HOXD9; HOXD1; HOXC13; ELAVL2; POLR3D; GMNN; |
