HOXC8 Antibody - N-terminal region - FITC
Referência ARP39557_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
HOXC8 Antibody - N-terminal region : FITC (ARP39557_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-HOXC8 (ARP39557_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Additional Information | IHC Information: Small intestine, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Small intestine, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC8 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HOXC8 (ARP39557_P050-FITC) antibody is Catalog # AAP39557 (Previous Catalog # AAPP23084) |
| Reference | Kikugawa,T., (2006) Prostate 66 (10), 1092-1099 |
|---|---|
| Gene Symbol | HOXC8 |
| Gene Full Name | Homeobox C8 |
| Alias Symbols | HOX3, HOX3A |
| NCBI Gene Id | 3224 |
| Protein Name | Homeobox protein Hox-C8 |
| Description of Target | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-935 BC053898.1 1-935 936-1866 BC053898.1 937-1867 1867-2290 BU618342.1 3-426 c |
| Uniprot ID | P31273 |
| Protein Accession # | NP_073149 |
| Nucleotide Accession # | NM_022658 |
| Protein Size (# AA) | 242 |
| Molecular Weight | 28kDa |
| Protein Interactions | UBC; PBX1; HOMEZ; GMNN; SMAD6; BTG2; SMAD1; BMPR1A; SMAD4; JUN; MSX1; DLX5; DLX2; KMT2A; |
