HOXA11 Antibody - C-terminal region - FITC
Referência ARP39495_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
HOXA11 Antibody - C-terminal region : FITC (ARP39495_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-HOXD11 (ARP39495_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA11 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: FFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSAN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HOXD11 (ARP39495_P050-FITC) antibody is Catalog # AAP39495 |
| Gene Symbol | HOXA11 |
|---|---|
| Gene Full Name | homeobox D11 |
| Alias Symbols | HOX1, HOX1I, RUSAT1 |
| NCBI Gene Id | 3207 |
| Protein Name | Homeobox protein Hox-D11 |
| Description of Target | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia. |
| Uniprot ID | P31270 |
| Protein Accession # | NP_005514 |
| Nucleotide Accession # | NM_005523 |
| Protein Size (# AA) | 313 |
| Molecular Weight | 34kDa |
| Protein Interactions | PGBD3; UBC; YY1; HDAC2; HDAC1; FOXO1; GMNN; MEIS1; CREBBP; |
