GSTA3 Antibody - middle region - Biotin
Referência ARP48484_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
GSTA3 Antibody - middle region : Biotin (ARP48484_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-GSTA3 (ARP48484_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GSTA3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Mouse: 79%; Sheep: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GSTA3 (ARP48484_P050-Biotin) antibody is Catalog # AAP48484 (Previous Catalog # AAPY01425) |
| Gene Symbol | GSTA3 |
|---|---|
| Gene Full Name | Glutathione S-transferase alpha 3 |
| Alias Symbols | GTA3, GSTA3-3 |
| NCBI Gene Id | 2940 |
| Protein Name | Glutathione S-transferase A3 |
| Description of Target | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. |
| Uniprot ID | Q16772 |
| Protein Accession # | NP_000838 |
| Nucleotide Accession # | NM_000847 |
| Protein Size (# AA) | 222 |
| Molecular Weight | 25kDa |
| Protein Interactions | BAG3; APP; |
