gL Recombinant Protein
Referência OPCA03448-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
GL Recombinant Protein (HHV-4) (OPCA03448)
| Datasheets/Manuals | Printable datasheet for GL Recombinant Protein (HHV-4) (OPCA03448) |
|---|
| Predicted Species Reactivity | Epstein-Barr virus|Epstein-Barr Virus|Human Gammaherpesvirus 4 |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Epstein-Barr virus |
| Additional Information | Relevance: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Fusion of EBV with B-lymphocytes requires the additional receptor-binding protein gp42, which forms a complex with gH/gL. May also be required for virus attachment to epithelial cells |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG |
| Protein Sequence | NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 23-137 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | The Epstein-Barr virus (EBV) BZLF2 gene product associates with the gH and gL homologs of EBV and carries an epitope critical to infection of B cells but not of epithelial cells.Li Q., Turk S.M., Hutt-Fletcher L.M.J. Virol. 69:3987-3994(1995) |
|---|---|
| Gene Symbol | BKRF2 |
| Gene Full Name | envelope glycoprotein L |
| Alias Symbols | envelope glycoprotein L, HHV4_BKRF2. |
| NCBI Gene Id | 3783710 |
| Protein Name | Envelope glycoprotein L |
| Description of Target | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH. Fusion of EBV with B-lymphocytes requires the additional receptor-binding protein gp42, which forms a complex with gH/gL. |
| Uniprot ID | P03212 |
| Protein Accession # | YP_401678.1 |
| Nucleotide Accession # | NC_007605.1 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 28.7 kDa |