Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
Identificar-se
Forgot your password?
Open account
pt en es
0
0
Ver carrinho
  • Catálogo
  • Áreas de investigação
  • Diagnóstico
  • Serviços
  • Recursos técnicos
  • Promoções
  • Contacto
Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
Quimigen Portugal > FGFR2 monoclonal antibody (MP01J), clone 1G3 (PE)

FGFR2 monoclonal antibody (MP01J), clone 1G3 (PE)

Imprimir Imprimir
Please log in

Referência H00002263-MP01J-50ug

Tamanho : 50ug

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Marca : Abnova

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

View product citations for antibody H00002263-MP01J on CiteAb
  • Specifications

    Product Description

    PE conjugated mouse monoclonal antibody raised against a partial recombinant FGFR2.
    This product is belong to Cell Culture Grade Antibody (CX Grade).Cell Culture Grade Antibody,Cell Culture Grade Antibodies,Cell Culture Grade,CX Grade,CXGrade,small size,trial size,MAB,monoclonal Ab,monoclonal antibody

    Immunogen

    FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (98); Rat (97)

    Conjugation

    PE

    Preparation Method

    Cell Culture Production

    Isotype

    IgG2b Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at 4°C.

  • Applications

    Flow Cytometry

    Immunofluorescence

    Protocol Download

    Western Blot

  • Gene Info — FGFR2

    Entrez GeneID

    2263

    GeneBank Accession#

    BC039243

    Protein Accession#

    AAH39243

    Gene Name

    FGFR2

    Gene Alias

    BEK, BFR-1, CD332, CEK3, CFD1, ECT1, FLJ98662, JWS, K-SAM, KGFR, TK14, TK25

    Gene Description

    fibroblast growth factor receptor 2

    Omim ID

    101200 101400 101600 123150 123500 123790 137215 149730 176943 207410

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq

    Other Designations

    BEK fibroblast growth factor receptor|FGF receptor|OTTHUMP00000020621|OTTHUMP00000020629|bacteria-expressed kinase|hydroxyaryl-protein kinase|keratinocyte growth factor receptor|protein tyrosine kinase, receptor like 14|soluble FGFR4 variant 4

  • Interactomes
    • FGFR2
  • Pathways
    • Endocytosis
    • MAPK signaling pathway
    • Pathways in cancer
    • Prostate cancer
    • Regulation of actin cytoskeleton
  • Diseases
    • Acrocephalosyndactylia
    • Adenocarcinoma
    • Alzheimer disease
    • Birth Weight
    • Breast cancer
    • Breast Neoplasms
    • Bronchial Hyperreactivity
    • Carcinoma
    • Cardiovascular Diseases
    • Cleft Lip
    • Cleft Palate
    • Craniofacial Dysostosis
    • Craniosynostoses
    • Cystadenocarcinoma
    • Depressive Disorder
    • Diabetes Complications
    • Disease Susceptibility
    • Endometrial Neoplasms
    • Endometriosis
    • Genetic Predisposition to Disease
    • Hypersensitivity
    • Hypospadias
    • Lymphatic Metastasis
    • Malignant melanoma
    • Melanoma
    • Metabolic Syndrome X
    • Neoplasm Invasiveness
    • Neoplasms
    • Osteoporosis
    • Ovarian cancer
    • Ovarian Neoplasms
    • Pancreatic cancer
    • Pancreatic Neoplasms
    • Schizophrenia
    • Skin Neoplasms
    • Sleep Apnea
    • Tobacco Use Disorder

    + View More Disease

    - View Less Disease

eProcurement
This product can not be ordered from your electronic catalog. A quotation will be created for this reference, would you like to continue? In this case, make sure that you have filled in the desired quantity
 


Rua Almada Negreiros Lote 5, Loja 14
2615-275 Alverca do Ribatejo - Portugal
Telefone: +351 30 8808 050
(Chamada para a rede fixa nacional)
Fax: +351 30 8808 052
(Chamada para a rede fixa nacional)
Email: info@quimigen.pt

Outras informações

Como encomendar ?
Condições de venda
Ofertas de emprego
Quem somos nós?
Newsletter
Políticas de qualidade
Eventos
Aviso legal

Todas as marcas comerciais ou marcas registradas que aparecem neste site são de propriedade de seus respectivos proprietários.
In
pt en es