EAP30 Antibody - N-terminal region - Biotin
Referência ARP31531_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
EAP30 Antibody - N-terminal region : Biotin (ARP31531_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-SNF8 (ARP31531_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Additional Information | IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EAP30 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SNF8 (ARP31531_P050-Biotin) antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305) |
| Sample Type Confirmation | SNF8 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985 |
|---|---|
| Gene Symbol | SNF8 |
| Gene Full Name | SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) |
| Alias Symbols | Dot3, EAP30, VPS22 |
| NCBI Gene Id | 11267 |
| Protein Name | Vacuolar-sorting protein SNF8 |
| Description of Target | ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM]. |
| Uniprot ID | Q96H20 |
| Protein Accession # | NP_009172 |
| Nucleotide Accession # | NM_007241 |
| Protein Size (# AA) | 258 |
| Molecular Weight | 29kDa |
| Protein Interactions | GOLGA2; VPS25; TRIM54; VAC14; UBC; BCAT1; SUV39H2; ACBD3; DUS3L; WDR12; PRMT6; RPUSD2; KDM1A; EFTUD2; TTC1; HARS; GTF2F1; GTF2E1; ELL; RBP1; MCM2; ADORA1; METTL14; NUDCD3; RILP; VPS36; CHMP6; VPS28; SNF8; TSG101; VPS20; NIF3L1; DVL2; |
