DUX3 Antibody - N-terminal region - FITC
Referência ARP35847_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
DUX3 Antibody - N-terminal region : FITC (ARP35847_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-DUX3 (ARP35847_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PCPSVKFRPGLPAMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRAC |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DUX3 (ARP35847_P050-FITC) antibody is Catalog # AAP35847 (Previous Catalog # AAPP08013) |
| Gene Symbol | DUX3 |
|---|---|
| Gene Full Name | Double homeobox 3 |
| Alias Symbols | - |
| NCBI Gene Id | 26582 |
| Protein Name | Putative double homeobox protein 3 |
| Description of Target | The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX3, resides within these 3.3-kb repeated elements. |
| Uniprot ID | Q96PT4-2 |
| Protein Accession # | NP_036280 |
| Nucleotide Accession # | NM_012148 |
| Protein Size (# AA) | 170 |
| Molecular Weight | 19kDa |
| Protein Interactions | Dlg4; |
