DAZ2 Antibody - N-terminal region - HRP
Referência ARP40250_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
DAZ2 Antibody - N-terminal region : HRP (ARP40250_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-DAZ2 (ARP40250_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DAZ2 (ARP40250_P050-HRP) antibody is Catalog # AAP40250 (Previous Catalog # AAPS02809) |
| Sample Type Confirmation | DAZ2 is strongly supported by BioGPS gene expression data to be expressed in Daudi |
| Reference | Kuo,P.L., (2004) Fertil. Steril. 81 (4), 1034-1040 |
|---|---|
| Gene Symbol | DAZ2 |
| Gene Full Name | Deleted in azoospermia 2 |
| Alias Symbols | pDP1678 |
| NCBI Gene Id | 57055 |
| Protein Name | Deleted in azoospermia protein 2 |
| Description of Target | DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Uniprot ID | Q2KHN6 |
| Protein Accession # | NP_001005785 |
| Nucleotide Accession # | NM_001005785 |
| Protein Size (# AA) | 534 |
| Molecular Weight | 59kDa |
| Protein Interactions | UBC; PUM2; |
