CREBL1 Antibody - middle region - FITC
Referência ARP31562_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
CREBL1 Antibody - middle region : FITC (ARP31562_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ATF6B (ARP31562_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CREBL1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 85%; Rat: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ATF6B (ARP31562_P050-FITC) antibody is Catalog # AAP31562 (Previous Catalog # AAPP02340) |
| Reference | Xie,T., (2003) Genome Res. 13 (12), 2621-2636 |
|---|---|
| Gene Symbol | ATF6B |
| Gene Full Name | Activating transcription factor 6 beta |
| Alias Symbols | G13, CREBL1, CREB-RP |
| NCBI Gene Id | 1388 |
| Protein Name | Cyclic AMP-dependent transcription factor ATF-6 beta |
| Description of Target | ATF6B(CREBL1) is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. ATF6B is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q99941 |
| Protein Accession # | NP_004372 |
| Nucleotide Accession # | NM_004381 |
| Protein Size (# AA) | 703 |
| Molecular Weight | 77kDa |
| Protein Interactions | CREBZF; XBP1; ATF6B; CDK6; UBC; SUMO2; ATF6; NFYC; MBTPS1; PHOX2A; MBTPS2; NFYA; HCVgp1; |
