CDTA Protein, E. coli, Recombinant (His)
Referência NB-64-49282-100ug
Tamanho : 100ug
Marca : Neo Biotech
Remove All
CDTA Protein, E. coli, Recombinant (His)
(Synonyms: Cytolethal distending toxin subunit A, cdtA, CDT A) Copy Product InfoSynonyms: Cytolethal distending toxin subunit A, cdtA, CDT A
Catalog No. TMPH-00604 Copy Product Info
CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q46668 |
| Amino Acid | CSSGKNKAYLDPKVFPPQVEGGPTVPSPDEPGLPLPGPGPALPTNGAIPIPEPGTAPAVSLMNMDGSVLTMWSRGAGSSLWAYYIGDSNSFGELRNWQIMPGTRPNTIQFRNVDVGTCMTSFPGFKGGVQLSTAPCKFGPERFDFQPMATRNGNYQLKSLSTGLCIRANFLGRTPSSPYATTLTMERCPSSGEKNFEFMWSISEPLRPALATIAKPEIRPFPPQPIEPDEHSTGGEQ |
| Construction | 22-258 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Cytolethal distending toxin subunit A, cdtA, CDT A |
| Research Background | CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB. |
| Molecular Weight | 29.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
CDT-A
Related Tags: CDTA Protein, E. coli, Recombinant (His) chemical structure | CDTA Protein, E. coli, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

