CD9 Recombinant Protein

Referência NB-21-24437

Tamanho : 100ug

Marca : Neo Biotech

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P21926
Molecular weight:
10.5kDa
Ser112~Ile195 His

Specifications CD9 Recombinant Protein

Product name PX-P4076-100
Uniprot ID P21926
Uniprot link http://www.uniprot.org/uniprot/P21926
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 10.5kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser112~Ile195
Aliases /Synonyms MIC3, TSPAN29
Reference PX-P4076
Note For research use only.
Molecular Constructor
Ser112~Ile195 His
Product name PX-P4076-1MG
Uniprot ID P21926
Uniprot link http://www.uniprot.org/uniprot/P21926
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 10.5kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser112~Ile195
Aliases /Synonyms MIC3, TSPAN29
Reference PX-P4076
Note For research use only.
Molecular Constructor
Ser112~Ile195 His
Product name PX-P4076-50
Uniprot ID P21926
Uniprot link http://www.uniprot.org/uniprot/P21926
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 10.5kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser112~Ile195
Aliases /Synonyms MIC3, TSPAN29
Reference PX-P4076
Note For research use only.
Molecular Constructor
Ser112~Ile195 His

Description

General Information about CD9 Recombinant Protein

The cluster of differentiation (CD) system is commonly used as a cell marker for immunophenotyping. Different types of cells in the immune system can be identified by surface CD molecules related to cellular immune function. More than 32 unique CD groups and subcategories have been identified. Some CD molecules act as important receptors or ligands for cells, starting a signal cascade and then altering the cell’s behavior. Some CD proteins are not involved in the cell signaling process, but have other functions, such as cell incorporation. CD9 is a member of the transmembrane superfamily 4, also known as the four transmembrane family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains, which is described as complex with integrins and other transmembrane members of superfamily 4. Found on the surface of exosomes. The protein interferes with cell signal transduction events and, therefore, plays a role in regulating cell development and activation, growth and movement. In addition, CD9 appears to play a key role in egg-sperm fusion during mammalian reproduction. CD9 is found in the oocyte membrane and appears to be able to intervene to maintain the normal shape of oocyte microvilli.

Documents

QC & Validation

Lorvotuzumab Biosimilar - Anti-NCAM1, CD56 mAb binds to CD56 Recombinant Protein in indirect ELISA Assay

Lorvotuzumab Biosimilar - Anti-NCAM1, CD56 mAb binds to CD56 Recombinant Protein in indirect ELISA Assay

Immobilized CD56 Recombinant Protein (cat. No.PX-P4123) at 0.5µg/mL (100µL/well) can bind to Lorvotuzumab Biosimilar - Anti-NCAM1, CD56 mAb (cat. No.PX-TA1047) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

3D Representation

CD9 Recombinant Protein

Publications

  • Nahide Zeren Arda Ozturk, Oliwia Barbara Majchrzak, Gianluca Ulivi, Petek Ballar Kirmizibayrak, Gerrit Borchard, Viorica Patrulea, Ozgen Ozer,Fully synthetic, nature-inspired exosome-mimetics for melanoma therapy, International Journal of Pharmaceutics, Volume 693, 2026, 126715, ISSN 0378-5173, https://doi.org/10.1016/j.ijpharm.2026.126715

Reviews

There are no reviews yet.

Be the first to review “CD9 Recombinant Protein” Cancel reply

Related products

  • SDS-PAGE for Monalizumab Biosimilar - Anti-KLRC1, NKG2A, CD159a, CD94 mAb - Research Grade

    PX-TA1392

    Monalizumab Biosimilar – Anti-KLRC1, NKG2A, CD159a, CD94 mAb – Research Grade