- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant C9orf61.
Immunogen
C9orf61 (NP_004807, 383 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QIMAPLQPSTSRAHRLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.59 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
ELISA
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C9orf61 is approximately 0.1ng/ml as a capture antibody.Western Blot (Cell lysate)
C9orf61 monoclonal antibody (M01), clone 1H3 Western Blot analysis of C9orf61 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
- Gene Info — C9orf61
Entrez GeneID
9413GeneBank Accession#
NM_004816Protein Accession#
NP_004807Gene Name
C9orf61
Gene Alias
MGC142243, MGC142245, RP11-548B3.1, X123
Gene Description
chromosome 9 open reading frame 61
Omim ID
607710Gene Ontology
HyperlinkOther Designations
Friedreich ataxia region gene X123|OTTHUMP00000063356
- Interactomes
- Publication Reference
- Generation of a FAM189A2/ENTREP1 knockout human induced pluripotent stem cell line using CRISPR/Cas9 technology.
Sibylle Marteau, Laetitia Duboscq-Bidot, Takanori Aizawa, Matthieu Hamlin, Eric Villard, Pascale Guicheney, Vincent Fontaine.
Stem cell research 2025 Oct; 89:103857.
Application:IF, WB-Ce, Human, ICANi002-A cells.
- Generation of a FAM189A2/ENTREP1 knockout human induced pluripotent stem cell line using CRISPR/Cas9 technology.
C9orf61 monoclonal antibody (M01), clone 1H3
Referência H00009413-M01
Tamanho : 100ug
Marca : Abnova
Images




