Bloc1s2 Antibody - N-terminal region - HRP

Referência ARP55703_P050-HRP

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Bloc1s2 Antibody - N-terminal region : HRP (ARP55703_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-Bloc1s2 (ARP55703_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE
Concentration0.5 mg/ml
Blocking PeptideFor anti-Bloc1s2 (ARP55703_P050-HRP) antibody is Catalog # AAP55703
Subunit2
Gene SymbolBloc1s2
Gene Full NameBiogenesis of lysosome-related organelles complex-1, subunit 2
Alias SymbolsBL, Bloc, BLOS2, Bloc1s2a, 2410089B13Rik
NCBI Gene Id73689
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit 2
Description of TargetBloc1s2 may play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. It plays a role in intracellular vesicle trafficking.
Uniprot IDQ9CWG9
Protein Accession #NP_082883
Nucleotide Accession #NM_028607
Protein Size (# AA)143
Molecular Weight15kDa